Our health essays are perfect for students who are studying health related courses. Whether you’re doing your degree or studying for a health related course at college, use our student-donated health resources to help you prepare your own work.
Obesity is a local, national, and international problem. Over the past 25 years obesity rates in England have increased by more than 50% and being overweight has become accepted as a norm for adults, with estimates that by 2050 half the population will be obese (Foresight, 2007). As a society the UK is less active … Read more
The given work, directed towards the identification of vaccine candidates for Atherosclerosis caused by the factors of Periodontitis and this has resulted in the prediction of some acceptable epitopes that can be used to elicit immune response against both Atherosclerosis and Periodontitis. WDAPNGTPNPNPNPNPNPNPGTTTLSESFENGIPASWKTIDADGDGHGWKPGNAPGIAGYNSNGCV, LDDPFILRDVRGQVVNFAPLQYNPVTKTLRIYTEITVAVSET and SNLYSANFEYLIPANADPVVITQNIIVTGQGEVVIPGGVYDYCITN are recognised as B-cell epitopes. These epitope stretches contain … Read more
Cancer is one of the main causes of mortality worldwide and this is nearly 7.6 million people died of cancer (around 13% of all deaths) in 2008. From those days to now, affecting of cancer on the death incidence increased accordingly. According to the World Health Organization (WHO), there will be 15 million new cases … Read more
The objective of the current study was to contribute to effective and qualitative teleophthalmology examination in order to increase telemedicine activities by determining the inter-rater reliability of the diagnosis and management plan between optometrists and ophthalmologists in evaluating eye diseases, and by reporting on performance indicators for efficiency and quality. Therefore, the present study answered … Read more
Towards the end of the inflammatory phase, the proliferation phase begins. During this phase, the tissue is reconstructed and new blood vessels are formed (Mostafa et al. 2006). Normally it last from day 4-21 after injury (Gurtner 2006). Towards the beginning of the proliferative phase, approximately 3-5 days after injury, formation of granulation tissue begins … Read more
Cancer is one of the main causes of mortality worldwide and this is nearly 7.6 million deaths (around 13% of all deaths) in 2008. From those days to now, cancer effecting on the death incidence increased accordingly. According to the World Health Organization (WHO), there will be 15 million new cases of cancer worlwide in … Read more
Steroids are becoming the most commonly used drug in the sport’s world today. “I will use whatever influence and popularity that I have to discourage young athletes from taking any drug that is not recommended by a doctor. What I will not do, however, is participate in naming names and implicating my friends and teammates.” … Read more
Similar to the approach of Kuttan et al. (2004), Y.P. Hwang et al (2011) carried out his investigation on piperine, even though not on the same research line of Kuttan et al (2004), at the molecular level, involving matrix metalloproteases (MMPs) which play a vital role in the tissue invasion, angiogenesis, inflammatory tissue destruction and … Read more
Cardiovascular disease (CVD) is the leading cause of non-communicable disease deaths worldwide (World Health Organization, 2014). The World Health Organization predicts that the number of deaths caused by CVD will reach 23.3 million by 2030. CVD is an umbrella term that encompasses a group of disorders of the heart and blood vessels. These diseases include … Read more
ABSTRACT: Meconium peritonitis is a nonbacterial, chemical inflammation of the peritoneum caused by escape of meconium into the peritoneal cavity, either in fetal life, at the time of delivery, or very shortly after delivery. The escape of meconium is due to an abnormal opening somewhere in the intestine,It is associated with bowel obstruction due to … Read more
This was the beginning of the therapeutic relationship as we engaged in a conversation where he explained he was feeling scared about going to operation theatre the next day. I didn’t dismiss his feelings and concerns, yet I assured him that he was in the best hands and would be taken care of. I discussed … Read more
If people hear the word Steroids the first thing that comes to mind is something bad or negative thoughts about steroids. But it’s not that bad. Steroids have received a bad reputation because of the people that uses them in a bad way. That’s the purpose of this Essay, give information about the Steroids, and … Read more
Acquired immunodeficiency syndrome (AIDS) represents the late stage of human immunodeficiency virus (HIV) infection which causes progressive depletion of a person’s defense system, therefore predisposing oneself to the complications of superimposed secondary infectionseor tumors. Since AIDS was first reported in 1980s, it has rapidly spread across the world. According to UNAIDS, approximately 35 million people … Read more
This project is part of the framework of medical radiotherapy. It focus on the method of evaluating of the Dose Convolution Integrals for a Pencil Beam Model for proton therapy. The method we are going to use is the Fast Gaussian Transform (FGT). The current planning system used for proton therapy uses a simple ray- … Read more
The prospect of surgery can be a stressful time. An individual who is experiencing stress often can have high level of anxiety and their cognitive thinking may decrease. Moreover, for an individual to successful assess a situation and determine coping strategies, if one’s cognitive abilities are decrease then the one ability to cope is affected. … Read more
