Essay Sauce

Established in 2017, Essay Sauce is a collaborative team of experienced academics, educators, and subject specialists, many qualified to PhD level, dedicated to providing students with insightful guidance and high-quality essay examples. The team meticulously reviews each essay, offering practical advice, essential reference materials, and actionable insights to help students enhance their academic writing skills. By combining rigorous academic standards with clear, approachable guidance, Essay Sauce aims to empower students in achieving academic excellence.

Vaccine candidates for Atherosclerosis

by

The given work, directed towards the identification of vaccine candidates for Atherosclerosis caused by the factors of Periodontitis and this has resulted in the prediction of some acceptable epitopes that can be used to elicit immune response against both Atherosclerosis and Periodontitis. WDAPNGTPNPNPNPNPNPNPGTTTLSESFENGIPASWKTIDADGDGHGWKPGNAPGIAGYNSNGCV, LDDPFILRDVRGQVVNFAPLQYNPVTKTLRIYTEITVAVSET and SNLYSANFEYLIPANADPVVITQNIIVTGQGEVVIPGGVYDYCITN are recognised as B-cell epitopes. These epitope stretches contain … Read more

Critical thinking

by

The way we think affects all aspects of our private and social life and education is not an exception. Human beings think differently and teachers who have key roles in education do so. Recently proper attention has been given to the ways teachers think (Calderhead, 1987) and now teaching is more characterized as a thinking … Read more

The liquidity and Working Capital structure of Oil and Gas Industries

by

ABSTRACT Oil and Gas Industry plays a vital role in the socio-economic progress of India. This study is intended to make obvious the liquidity and Working Capital structure of Oil and Gas Industries, this study is mainly based on secondary data and the statistical tools like Mean, Standard Deviation, Coefficient Of Variance and Analysis Of … Read more

What is theatre?

by

What is theatre? What is it about? What has it shown us and most importantly what has it taught us? Theatre is a ‘collaborative form of fine art that uses live performers to present the experience of a real or an imagined event. ‘ Theatre is an enrichment that is full of experiences. It teaches … Read more

Mass communication

by

Mass communication plays an extensive role in an individual’s daily life. Right from the second you wake up till you go to bed after saying goodnight to your wife, kid, parents, siblings or friends, you are surrounded in a world built just for you by the media. With the help of technology, there has been … Read more

Defining fundamental pedagogic

by

Fundamental pedagogic is the relationship between learner and educator. This relationship positions the learner as being a child and the educator is the one accompanying the child through the complex world. The learner, thus, does not have enough understanding of the world and requires input to get through the dangers of the world and therefore … Read more

Advertising effect on purchasing decisions

by

We collected data through both primary and secondary sources. For the collection of primary data, we prepared a structured questionnaire aimed at knowing what advertisement platforms effect the consumption patterns of customers. This questionnaire was floated through the internet. The total number of respondents was 95 but some of them were redundant. So after filtering, … Read more

Collective Good Problems: Addressing Deforestation in the Amazon Rainforest

by

Deforestation is the act of cutting down or burning all the trees in an area. It seems that some people are thriving on the suffering of others by using the forests for urban use, and logging industries.??While the poor need these forests as a basic means of survival, others are cutting down these forests to … Read more

DMC (business)

by

DMC needs to identify their main business problems and develop a new strategy along with procedures to address it. Although DMC had grown into a multi-billion dollar company and regularly ranks in the top of the industry, gross margins have decreased steadily between 2010 and 2012. Depicted the Table 1 below, margins ranged from a … Read more

Criminal psychology

by

Have you ever wondered what causes Serial Killers and Psychopaths to do what they do? Here you may find reasons to explain the actions of these individuals as well as the findings of psychologists who specialize in this field. Psychologists that specialize in these individuals are Criminal and Forensic Psychologists. Criminal psychology is the study … Read more

The RIO 2012 – United Nations Conference on Sustainable Development (UNCSD)

by

The RIO 2012, also known United Nations Conference on Sustainable Development (UNCSD) or Earth Summit 2012, which took place in Rio de Janeiro, Brazil in June 2012 ‘ twenty years after the landmark 1992 Earth Summit in Rio. It was the third international conference on sustainable development. It also is aimed at reconciling the economic … Read more

Post World War I

by

After World War I, there were a lot of celebration in welcoming the American boys whom were coming back home. Many technological improvement as well as many discoveries in science lead to an economic bloom. Many people took advantage of this, and this surely sent America into the great depression. Following the 1920 and the … Read more

Conflict Minerals Reporting

by

– Disclosures and Reporting Requirements – I. INTRODUCTION Armed groups in Central Africa earn millions of dollars every year by trading minerals extracted from the armed conflict regions of the Democratic Republic of the Congo (DRC). Those minerals are called conflict minerals and are extracted for the use of funding for the conflicts in those … Read more