Purpose : Improve the accuracy of a classifier by using minimum number of features. Multiple feature selection techniques are proposed which helping to find out the most important features. In this paper, feature selection methods Co-relation based feature Selection, Wrapper method and Information Gain are used, before applying supervised learning based classification techniques to show … Read more
In business world, the perspectives of entrepreneurial Strategies are crucial for growth. Driven by this urge, the strategic management has modeled concepts and principles towards this managerial cause. In its approach, the strategy evaluates the business operational environment and focus on the inner working of a company. In this case, it develops methodological advances and … Read more
Introduction: Cereal During the 19Th century many people suffered from digestion problems. The cause was their diet. Which lacked grains. Granula was one of the first ‘cereals’ to be developed. Dr.James Caleb Jackson was responsible for this discovery, by mixing and baking graham flower and water he had made the first ready-to-eat cereal. However this … Read more
‘ What is reentry? Is it effective? This is when someone has been incarcerated for a long period of time, and now they are released and returning to society. Or they may be getting out on good behavior and they could be placed on parole or probation to serve the remainder of their time. Reentry … Read more
The economic crisis was beginning to affect economies in Malaysia in July 1997, these were caused many companies fall into financial distress and facing the threat of unable to pay debt and difficult to fulfill corporate obligations due to there was unable to cope with the economic downturn (Low et al., 2001). The Impact of … Read more
Hameed and Nazir (2014) argue that liberalization neutralises unemployment, citing Pakistan, as one of nations where trade liberalization has helped reduce job losses. Complementing the argument, Siddiqui and Kemal (2002) state that after liberalization, employment and production increased, generating demand for labour and imports. This dropped unemployment and reduced poverty, as economic and living standards … Read more
In order to obtain government funding for major projects, the government agencies must follow the approval and assurance guidance processes as outlined by the Treasury of the UK. These revised procedures for the assurance, major projects support, and ensuring integration with strengthened Treasury approval processes were introduced in 2011 (HM Treasury 2012). The main areas … Read more
RESULT AND DISCUSSION This investigation has been discussed with dyeing industry effluent of various groundwater samples collected from surrounding areas of dyeing industry in and around chellandipalayam at karur district. The physico-chemical parameters such as colour,turbidity,TDS,alkalinity,electrical conductivity, total hardness, calcium, magnesium, chloride, nitrate, COD, iron, copper and chromium, were determined by using the standard procedures. … Read more
Introduction Soccer is one of the most popular and most played sports in the world. A very important aspect in every sport, and also in soccer, is youth development and identification. Anticipation is a key parameter in the field of youth development and identification. Soccer players has to deal with a complex and quickly changing … Read more
Introduction There is a new trend in drug use in today’s society. Synthetic drugs have been on the rise mostly among young teens and have created many problems such as health risks and controversy with the government. Synthetic drugs are being chemically created in laboratories and in some households, made with easily accessible chemicals and … Read more
This popular book series has also proved it success on the big screen and here are 50 facts about both the film and the book which is a futuristic tale about teenagers who are forced to fight each other to death in order to survive. 1. The fascinating Greek myth revolving around Theseus, the brave … Read more
One subsystem of behavioral analysis is the influence of actions and actors on the perceived severity of workplace bullying. Workplace bullying is a form of employee abuse. Half of American workers have witnessed or who been a victim of one or more forms of mistreatment at work. Workplace bullying does occur frequently and it does … Read more
Obesity is a local, national, and international problem. Over the past 25 years obesity rates in England have increased by more than 50% and being overweight has become accepted as a norm for adults, with estimates that by 2050 half the population will be obese (Foresight, 2007). As a society the UK is less active … Read more
The given work, directed towards the identification of vaccine candidates for Atherosclerosis caused by the factors of Periodontitis and this has resulted in the prediction of some acceptable epitopes that can be used to elicit immune response against both Atherosclerosis and Periodontitis. WDAPNGTPNPNPNPNPNPNPGTTTLSESFENGIPASWKTIDADGDGHGWKPGNAPGIAGYNSNGCV, LDDPFILRDVRGQVVNFAPLQYNPVTKTLRIYTEITVAVSET and SNLYSANFEYLIPANADPVVITQNIIVTGQGEVVIPGGVYDYCITN are recognised as B-cell epitopes. These epitope stretches contain … Read more
This report is about one type of control panel which is ‘Automatic Power Factor Control (APFC) based on PLC’. In our vast power system inductive loads are more. Therefore power factor is usually lagging in nature. This results in large current which inturn increases the machine size & losses, reduces efficiency and also has many … Read more
